Product Description
Size: 20ul / 150ul
The POLR2L (15779-1-AP) by Proteintech is a Polyclonal antibody targeting POLR2L in WB, ELISA applications with reactivity to human, mouse, rat samples
15779-1-AP targets POLR2L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Raji cells, HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag8468 Product name: Recombinant human POLR2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC005903 Sequence: MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK Predict reactive species
Full Name: polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
Calculated Molecular Weight: 67 aa, 8 kDa
Observed Molecular Weight: 8 kDa
GenBank Accession Number: BC005903
Gene Symbol: POLR2L
Gene ID (NCBI): 5441
RRID: AB_2167979
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P62875
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924