Iright
BRAND / VENDOR: Proteintech

Proteintech, 15783-1-AP, UFC1 Polyclonal antibody

CATALOG NUMBER: 15783-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UFC1 (15783-1-AP) by Proteintech is a Polyclonal antibody targeting UFC1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15783-1-AP targets UFC1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The function of UFC1 (ubiquitin fold modifier conjugating enzyme 1) has not been widely studied, and is yet to be fully elucidated. The MW of this protein is 21 kDa, and this antibody specially recognises the 21 kDa protein. Catalog#15783-1-AP specially recognises the 21 kDa protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8480 Product name: Recombinant human UFC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC005187 Sequence: MADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITCPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ Predict reactive species Full Name: ubiquitin-fold modifier conjugating enzyme 1 Calculated Molecular Weight: 167 aa, 19 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC005187 Gene Symbol: UFC1 Gene ID (NCBI): 51506 RRID: AB_2213938 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3C8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924