Iright
BRAND / VENDOR: Proteintech

Proteintech, 15788-1-AP, ANAPC10 Polyclonal antibody

CATALOG NUMBER: 15788-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANAPC10 (15788-1-AP) by Proteintech is a Polyclonal antibody targeting ANAPC10 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15788-1-AP targets ANAPC10 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:200 Background Information Anaphase-promoting complex subunit 10 (Anapc10) is a component of the promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase.Anapc10 recognizes ubiquitination-mediated degradation of substrates, and is expressed predominantly in the cytoplasm of spermatogonial and leptoblast cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8487 Product name: Recombinant human ANAPC10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC005217 Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR Predict reactive species Full Name: anaphase promoting complex subunit 10 Calculated Molecular Weight: 185 aa, 21 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC005217 Gene Symbol: ANAPC10 Gene ID (NCBI): 10393 RRID: AB_3669220 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UM13 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924