Proteintech, 15796-1-AP, BAP29 Polyclonal antibody

Size: 20ul / 150ul The BAP29 (15796-1-AP) by Proteintech is a Polyclonal antibody targeting BAP29 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 15796-1-AP targets BAP29 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, COLO 320 cells, Raji cells, U-87 MG cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8505 Product name: Recombinant human BCAP29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-241 aa of BC008478 Sequence: RRLVTLITQLAKELSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKRL Predict reactive species Full Name: B-cell receptor-associated protein 29 Calculated Molecular Weight: 241 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC008478 Gene Symbol: BAP29 Gene ID (NCBI): 55973 RRID: AB_2065118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.