Proteintech, 15802-1-AP, NHP2L1 Polyclonal antibody

Size: 20ul / 150ul The NHP2L1 (15802-1-AP) by Proteintech is a Polyclonal antibody targeting NHP2L1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15802-1-AP targets NHP2L1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, mouse pancreas tissue, HepG2 cells, Jurkat cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue, MCF-7 cells Positive IHC detected in: human cervical cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NHP2L1, belongs to the ribosomal protein L7Ae family, is a component of the spliceosome complex. It is recruited to introns following the attachment of U4 and U6 RNAs, and is required for subsequent recruitment of PRP31 and activation of the spliceosomal complex [PMID: 17412961]. It binds to the 5'-stem-loop of U4 snRNA and may have a role in the late stage of spliceosome assembly. The protein undergoes a conformational change upon RNA-binding [PMID: 10545122]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8532 Product name: Recombinant human NHP2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC005358 Sequence: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV Predict reactive species Full Name: NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) Calculated Molecular Weight: 128 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC005358 Gene Symbol: NHP2L1 Gene ID (NCBI): 4809 RRID: AB_2251452 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.