Proteintech, 15804-1-AP, GLRX Polyclonal antibody

Size: 20ul / 150ul The GLRX (15804-1-AP) by Proteintech is a Polyclonal antibody targeting GLRX in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15804-1-AP targets GLRX in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human milk, mouse lung tissue, Jurkat cells, human placenta tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8535 Product name: Recombinant human GLRX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-106 aa of BC005304 Sequence: MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ Predict reactive species Full Name: glutaredoxin (thioltransferase) Calculated Molecular Weight: 106 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC005304 Gene Symbol: GLRX Gene ID (NCBI): 2745 RRID: AB_11232210 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35754 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.