Proteintech, 15808-1-AP, Alpha B Crystallin Polyclonal antibody

Size: 20ul / 150ul The Alpha B Crystallin (15808-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha B Crystallin in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15808-1-AP targets Alpha B Crystallin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, U2OS cells, rat heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IP detected in: U2OS cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Alpha B-crystallin, encoded by CRYAB gene, is multifunctional, serving as both a major structural protein in the lens and a small heat-shock protein in other tissues in mammals. Alpha B-crystallin may contribute to the transparency and refractive index of the lens. Single nucleotide polymorphisms (SNPs) in the promoter region of CRYAB gene have been associated with in multiple sclerosis. Mutations in the CRYAB gene cause distinct clinical phenotypes including isolated posterior polar cataract, myofibrillar myopathy, cardiomyopathy, or a multisystemic disorder combining all these features. Impairment of alpha-B crystallin dimerization may be relevant to the pathogenesis of these disorders. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, fish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8543 Product name: Recombinant human aB-Crystallin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-175 aa of BC007008 Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK Predict reactive species Full Name: crystallin, alpha B Calculated Molecular Weight: 175 aa, 20 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC007008 Gene Symbol: Alpha B Crystallin Gene ID (NCBI): 1410 RRID: AB_2292175 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02511 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.