Iright
BRAND / VENDOR: Proteintech

Proteintech, 15809-1-AP, DNAL1 Polyclonal antibody

CATALOG NUMBER: 15809-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAL1 (15809-1-AP) by Proteintech is a Polyclonal antibody targeting DNAL1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 15809-1-AP targets DNAL1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue, mouse brain tissue, rat brain tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information DNAL1 was originally documented as the Chlamydomonas outer arm dynein axonemal light chain 1. DNAL1 has been documented to link components of the cytoskeleton with the molecular motor dynein, perhaps acting as a scaffold for larger functional structures (PMID: 22018492). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8545 Product name: Recombinant human DNAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC005343 Sequence: MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN Predict reactive species Full Name: dynein, axonemal, light chain 1 Calculated Molecular Weight: 151 aa, 17 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC005343 Gene Symbol: DNAL1 Gene ID (NCBI): 83544 RRID: AB_2095365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4LDG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924