Iright
BRAND / VENDOR: Proteintech

Proteintech, 15812-1-AP, UBE2O Polyclonal antibody

CATALOG NUMBER: 15812-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UBE2O (15812-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2O in WB, IHC, ELISA applications with reactivity to human samples 15812-1-AP targets UBE2O in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, Jurkat cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information UBE2O, also named as KIAA1734, belongs to the ubiquitin-conjugating enzyme family. It catalyzes the covalent attachment of ubiquitin to other proteins. UBE2O has a calculated molecular mass of 141 kDa, and many bands can be detected as 140-170 kDa and 200-230 kDa (PMID: 28774900, 23455153, 28774922, 11311559). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8580 Product name: Recombinant human UBE2O protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-343 aa of BC007822 Sequence: SSDSGPEAGSQRLLFSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKLYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVEEVQVVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVFPAKVEPAKIAWECPEKNCAQGEGSMAKKVKRL Predict reactive species Full Name: ubiquitin-conjugating enzyme E2O Calculated Molecular Weight: 1292 aa, 141 kDa Observed Molecular Weight: 150 kDa, 200-230 kDa GenBank Accession Number: BC007822 Gene Symbol: UBE2O Gene ID (NCBI): 63893 RRID: AB_2211192 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924