Iright
BRAND / VENDOR: Proteintech

Proteintech, 15814-1-AP, MYL1 Polyclonal antibody

CATALOG NUMBER: 15814-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYL1 (15814-1-AP) by Proteintech is a Polyclonal antibody targeting MYL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15814-1-AP targets MYL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, human heart tissue, mouse heart tissue, mouse skeletal muscle tissue, mouse skin tissue Positive IHC detected in: rat skeletal muscle tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8594 Product name: Recombinant human MYL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC005318 Sequence: MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI Predict reactive species Full Name: myosin, light chain 1, alkali; skeletal, fast Calculated Molecular Weight: 150aa,17 kDa; 194aa,22 kDa Observed Molecular Weight: 14-17 kDa, 22-25 kDa GenBank Accession Number: BC005318 Gene Symbol: MYL1 Gene ID (NCBI): 4632 RRID: AB_2266747 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05976 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924