Iright
BRAND / VENDOR: Proteintech

Proteintech, 15833-1-AP, Vitronectin/S-protein Polyclonal antibody

CATALOG NUMBER: 15833-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Vitronectin/S-protein (15833-1-AP) by Proteintech is a Polyclonal antibody targeting Vitronectin/S-protein in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 15833-1-AP targets Vitronectin/S-protein in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat plasma, human plasma, human testis tissue, NIH/3T3 cells Positive IHC detected in: human liver tissue, human hepatocirrhosis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Vitronectin is a glycoprotein present in blood and in the extracellular matrix (PMID: 10399314). Vitronectin is a multifunctional glycoprotein that mediates cell-to-substrate adhesion, inhibits the cytolytic action of the terminal complement cascade in vitro and binds to several serine protease inhibitors of the serpin family (PMID: 1372588). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, plasmodium falciparum Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8443 Product name: Recombinant human VTN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-478 aa of BC005046 Sequence: EVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL Predict reactive species Full Name: vitronectin Calculated Molecular Weight: 478 aa, 54 kDa Observed Molecular Weight: 70-75 kDa, 65 kDa GenBank Accession Number: BC005046 Gene Symbol: VTN Gene ID (NCBI): 7448 RRID: AB_2216309 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924