Iright
BRAND / VENDOR: Proteintech

Proteintech, 15845-1-AP, Pancreatic alpha-amylase Polyclonal antibody

CATALOG NUMBER: 15845-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Pancreatic alpha-amylase (15845-1-AP) by Proteintech is a Polyclonal antibody targeting Pancreatic alpha-amylase in WB, IHC, ELISA applications with reactivity to human, mouse samples 15845-1-AP targets Pancreatic alpha-amylase in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human liver tissue, mouse pancreas tissue Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information The complete human amylase gene contains five intact genes: two pancreatic genes (AMY2A and AMY2B) and three salivary genes (AMYIA, AMYIB, and AMYIC). AMY2A(Pancreatic alpha-amylase)is also named as PA and is a 56 kDa protein consisting of 496 amino acids in a single polypeptide chain, folded into three domains(PMID:10657258).AMY2A and AMY2B transcripts are present in the human pancreas but not in the parotid salivary gland, while AMY1 transcripts are present in the parotid gland but not in the pancreas(PMID:1692956). 15845-1-AP can recognize both AMY1 and AMY2. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8605 Product name: Recombinant human AMY2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-511 aa of BC007060 Sequence: DIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species Full Name: amylase, alpha 2A (pancreatic) Calculated Molecular Weight: 511 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC007060 Gene Symbol: Amylase Alpha Gene ID (NCBI): 279 RRID: AB_2242664 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04746 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924