Proteintech, 15861-1-AP, GMPR2 Polyclonal antibody

Size: 20ul / 150ul The GMPR2 (15861-1-AP) by Proteintech is a Polyclonal antibody targeting GMPR2 in WB, ELISA applications with reactivity to human samples 15861-1-AP targets GMPR2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, HepG2 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8394 Product name: Recombinant human GMPR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-366 aa of BC008021 Sequence: MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC Predict reactive species Full Name: guanosine monophosphate reductase 2 Calculated Molecular Weight: 409aa,45 kDa; 366aa,40 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC008021 Gene Symbol: GMPR2 Gene ID (NCBI): 51292 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2T1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.