Proteintech, 15862-1-AP, HLA-DRB1 Polyclonal antibody

Size: 20ul / 150ul The HLA-DRB1 (15862-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DRB1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 15862-1-AP targets HLA-DRB1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, human spleen tissue, A375 cells, Daudi cells Positive IP detected in: Raji cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8405 Product name: Recombinant human HLA-DRB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-227 aa of BC007920 Sequence: DTRPRFLEYSTSECHFFNGTERVRFLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK Predict reactive species Full Name: major histocompatibility complex, class II, DR beta 1 Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC007920 Gene Symbol: HLA-DRB1 Gene ID (NCBI): 3123 RRID: AB_1639897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01911 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.