Proteintech, 15873-1-AP, PLN Polyclonal antibody

Size: 20ul / 150ul The PLN (15873-1-AP) by Proteintech is a Polyclonal antibody targeting PLN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15873-1-AP targets PLN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Phospholamban (PLN) is a 52-amino-acid transmembrane protein found in the sarcoplasmic reticulum (SR) of cardiac muscle cells. It has been postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. Phospholamban has a homopentamer form(25-27 kDa). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8632 Product name: Recombinant human PLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC005269 Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL Predict reactive species Full Name: phospholamban Calculated Molecular Weight: 52 aa, 6 kDa Observed Molecular Weight: 10 kDa, 25 kDa GenBank Accession Number: BC005269 Gene Symbol: PLN Gene ID (NCBI): 5350 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.