Proteintech, 15875-1-AP, TNNC2 Polyclonal antibody

Size: 20ul / 150ul The TNNC2 (15875-1-AP) by Proteintech is a Polyclonal antibody targeting TNNC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15875-1-AP targets TNNC2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: human skeletal muscle tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8636 Product name: Recombinant human TNNC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC005323 Sequence: MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ Predict reactive species Full Name: troponin C type 2 (fast) Calculated Molecular Weight: 160 aa, 18 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC005323 Gene Symbol: TNNC2 Gene ID (NCBI): 7125 RRID: AB_2878194 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02585 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.