Proteintech, 15884-1-AP, FKBP14 Polyclonal antibody

Size: 20ul / 150ul The FKBP14 (15884-1-AP) by Proteintech is a Polyclonal antibody targeting FKBP14 in WB, IHC, ELISA applications with reactivity to human samples 15884-1-AP targets FKBP14 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FKBP14, also named as FKBP22, belongs to the family of FK506-binding peptidyl-prolyl cis-trans isomerases (PPIases). PPIases accelerate the folding of proteins during protein synthesis. FKBP14 is localized in the endoplasmic reticulum (ER) and that deficiency of FKBP14 leads to enlarged ER cisterns in dermal fibroblasts in vivo. FKBP14 is about 22kd. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8668 Product name: Recombinant human FKBP14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-211 aa of BC005206 Sequence: LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL Predict reactive species Full Name: FK506 binding protein 14, 22 kDa Calculated Molecular Weight: 211 aa, 24 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC005206 Gene Symbol: FKBP14 Gene ID (NCBI): 55033 RRID: AB_2102702 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.