Iright
BRAND / VENDOR: Proteintech

Proteintech, 15893-1-AP, TNNT1 Polyclonal antibody

CATALOG NUMBER: 15893-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TNNT1 (15893-1-AP) by Proteintech is a Polyclonal antibody targeting TNNT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 15893-1-AP targets TNNT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8702 Product name: Recombinant human TNNT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-297 aa of BC022086 Sequence: RMSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK Predict reactive species Full Name: troponin T type 1 (skeletal, slow) Calculated Molecular Weight: 252aa,27 kDa; 192aa,21 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC022086 Gene Symbol: TNNT1 Gene ID (NCBI): 7138 RRID: AB_2240819 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13805 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924