Proteintech, 15899-1-AP, NECAP2 Polyclonal antibody

Size: 20ul / 150ul The NECAP2 (15899-1-AP) by Proteintech is a Polyclonal antibody targeting NECAP2 in WB, ELISA applications with reactivity to human, mouse, rat samples 15899-1-AP targets NECAP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, HeLa cells, human liver tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8721 Product name: Recombinant human NECAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-263 aa of BC018914 Sequence: MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF Predict reactive species Full Name: NECAP endocytosis associated 2 Calculated Molecular Weight: 263 aa, 28 kDa Observed Molecular Weight: 35-37 kDa GenBank Accession Number: BC018914 Gene Symbol: NECAP2 Gene ID (NCBI): 55707 RRID: AB_2149187 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVZ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.