Proteintech, 15901-1-AP, ACOT9 Polyclonal antibody

Size: 20ul / 150ul The ACOT9 (15901-1-AP) by Proteintech is a Polyclonal antibody targeting ACOT9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 15901-1-AP targets ACOT9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, mouse heart tissue, mouse kidney tissue, rat kidney tissue Positive IHC detected in: mouse kidney tissue, human kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ACOT9 (Acyl-coenzyme A thioesterase 9) is a member of the acyl-CoA thioesterase superfamily, which is a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. ACOT9 has 4 isoforms with the molecular mass of 43-50 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8730 Product name: Recombinant human ACOT9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC012573 Sequence: MRRAALRLCALGKGQLTPGRGLTQGPQNPKKQGIFHIHEVRDKLREIVGASTNWRDHVKAMEERKLLHSFLAKSQDGLPPRRMKDSYIEVLLPLGSEPELREKYLTVQNTVRFGRILEDLDSLGVLICYMHNKIHSAKMSPLSIVTALVDKIDMCKKSLSPEQDIKFSGHVSWVGKTSMEVKMQMFQLHGDEFCPVLDATFVMVARDSENKG Predict reactive species Full Name: acyl-CoA thioesterase 9 Calculated Molecular Weight: 24 kDa, 49 kDa Observed Molecular Weight: 43-50 kDa GenBank Accession Number: BC012573 Gene Symbol: ACOT9 Gene ID (NCBI): 23597 RRID: AB_2221519 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y305 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.