Iright
BRAND / VENDOR: Proteintech

Proteintech, 15911-1-AP, KIF20A Polyclonal antibody

CATALOG NUMBER: 15911-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KIF20A (15911-1-AP) by Proteintech is a Polyclonal antibody targeting KIF20A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 15911-1-AP targets KIF20A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Caco-2 cells, HeLa cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KIF20A, also known as RAB6KIFL or MKlp2, is a kinesin originally identified as a binding partner for the rab6 GTPase involved in protein transport at the Golgi apparatus. KIF20A belongs to a large family of motor proteins that accumulate in mitotic cells and is required for normal cell division. KIF20A is thought to be involved in carcinogenesis. In normal tissues KIF20A is almost undetectable while it is overexpressed in various cancers. KIF20A has been identified as a novel promising candidate for anticancer immunotherapy. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8700 Product name: Recombinant human KIF20A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC012999 Sequence: MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSEDSMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHRFTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGILPRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTSLKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFSIWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQD Predict reactive species Full Name: kinesin family member 20A Calculated Molecular Weight: 890 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC012999 Gene Symbol: KIF20A Gene ID (NCBI): 10112 RRID: AB_2131434 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924