Iright
BRAND / VENDOR: Proteintech

Proteintech, 15914-1-AP, CTP synthase Polyclonal antibody

CATALOG NUMBER: 15914-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CTP synthase (15914-1-AP) by Proteintech is a Polyclonal antibody targeting CTP synthase in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 15914-1-AP targets CTP synthase in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Raji cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CTP synthase(CTPS) is also named as CTPS1 and belongs to the CTP synthase family. It catalyses the ATP-dependent formation of CTP from UTP using either L-glutamine or NH3 as the nitrogen source(PMID:12752439). It is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis (PMID:8813694). CTP synthetase exists as a dimer in the absence of its substrates ATP and UTP, but in the presence of saturating concentrations of these substrates the enzyme exists as a tetramer.(PMID:18439916) Specification Tested Reactivity: human Cited Reactivity: human, mouse, zebrafish, mosquito Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8707 Product name: Recombinant human CTPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-591 aa of BC009408 Sequence: ICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRIGSSSPDSEITELKFPSINHD Predict reactive species Full Name: CTP synthase Calculated Molecular Weight: 591 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC009408 Gene Symbol: CTPS Gene ID (NCBI): 1503 RRID: AB_2086513 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17812 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924