Proteintech, 15916-1-AP, Semenogelin-1 Polyclonal antibody

Size: 20ul / 150ul The Semenogelin-1 (15916-1-AP) by Proteintech is a Polyclonal antibody targeting Semenogelin-1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 15916-1-AP targets Semenogelin-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8717 Product name: Recombinant human SEMG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-312 aa of BC007096 Sequence: MKPNIIFVLSLLLILEKQAAVMGQKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQR Predict reactive species Full Name: semenogelin I Calculated Molecular Weight: 402aa,45 kDa; 462aa,52 kDa GenBank Accession Number: BC007096 Gene Symbol: Semenogelin-1 Gene ID (NCBI): 6406 RRID: AB_2270146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.