Iright
BRAND / VENDOR: Proteintech

Proteintech, 15919-1-AP, TSPAN18 Polyclonal antibody

CATALOG NUMBER: 15919-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPAN18 (15919-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN18 in WB, ELISA applications with reactivity to human samples 15919-1-AP targets TSPAN18 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information TSPAN18 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN18 gene mutation has been associated with Schizophrenia in Han Chinese (PMID: 22037552; 23505562). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8724 Product name: Recombinant human TSPAN18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-267 aa of BC019342 Sequence: NGPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTVILNTFETYVYLAGALAIGVLAIEEERAHSVSQATGILYQLPASPQAFQSPGTLGATA Predict reactive species Full Name: tetraspanin 18 Calculated Molecular Weight: 267 aa, 29 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC019342 Gene Symbol: TSPAN18 Gene ID (NCBI): 90139 RRID: AB_3669225 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96SJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924