Iright
BRAND / VENDOR: Proteintech

Proteintech, 15950-1-AP, UTP23 Polyclonal antibody

CATALOG NUMBER: 15950-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UTP23 (15950-1-AP) by Proteintech is a Polyclonal antibody targeting UTP23 in WB, ELISA applications with reactivity to human, mouse, rat samples 15950-1-AP targets UTP23 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information UTP23 is a component of ribosomal small-subunit processome, which is involved in ribosome synthesis and RNA maturation. UTP23 contains a long and likely unstructured tail at the C terminus of the PIN domain (PMID: 24152547). UTP23 is a target of genetic variation associated with colorectal cancer in chromosome 8q23.3, and it may coordinate with EIF3H in this region in the development of colorectal cancer. Low expression of UTP23 predicts poorer prognosis of ovarian cancer patients (PMID: 31540773, 37880005). It has 2 predicted molecular weight of 28 kDa and 17 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8609 Product name: Recombinant human UTP23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-249 aa of BC005955 Sequence: MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKRRKRKRIRNRSNPKVLSEKQNAEGE Predict reactive species Full Name: UTP23, small subunit (SSU) processome component, homolog (yeast) Calculated Molecular Weight: 249 aa, 28 kDa Observed Molecular Weight: 28 kDa, 17 kDa GenBank Accession Number: BC005955 Gene Symbol: UTP23 Gene ID (NCBI): 84294 RRID: AB_10644292 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924