Iright
BRAND / VENDOR: Proteintech

Proteintech, 15952-1-AP, MAT2B Polyclonal antibody

CATALOG NUMBER: 15952-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAT2B (15952-1-AP) by Proteintech is a Polyclonal antibody targeting MAT2B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15952-1-AP targets MAT2B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, Jurkat cells, mouse brain tissue, mouse testis tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human lung tissue, mouse lung tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8649 Product name: Recombinant human MAT2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-323 aa of BC005218 Sequence: MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH Predict reactive species Full Name: methionine adenosyltransferase II, beta Calculated Molecular Weight: 36 kDa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC005218 Gene Symbol: MAT2B Gene ID (NCBI): 27430 RRID: AB_10637268 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZL9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924