Proteintech, 15963-1-AP, Elafin/Skalp Polyclonal antibody

Size: 20ul / 150ul The Elafin/Skalp (15963-1-AP) by Proteintech is a Polyclonal antibody targeting Elafin/Skalp in IHC, IF/ICC, ELISA applications with reactivity to human samples 15963-1-AP targets Elafin/Skalp in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human skin cancer tissue, human oesophagus tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8735 Product name: Recombinant human PI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-117 aa of BC010952 Sequence: AAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ Predict reactive species Full Name: peptidase inhibitor 3, skin-derived Calculated Molecular Weight: 117 aa, 12 kDa GenBank Accession Number: BC010952 Gene Symbol: Elafin/Skalp Gene ID (NCBI): 5266 RRID: AB_2878201 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19957 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.