Proteintech, 15976-1-AP, PSMB10 Polyclonal antibody

Size: 20ul / 150ul The PSMB10 (15976-1-AP) by Proteintech is a Polyclonal antibody targeting PSMB10 in WB, IHC, ELISA applications with reactivity to human samples 15976-1-AP targets PSMB10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, human liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The proteasome subunit, beta type 10 (PSMB10) gene regulated by interferon-gamma is a core part of the 26S proteasome complex, which is an important protein degrading system. Study identifies immunosubunit PSMB10 as a novel regulator that contributes to Ang II-induced atrial fibrillation (AF) and suggests that inhibition of PSMB10 may represent a potential therapeutic target for treating hypertensive AF. (PMID: 29507100, PMID: 16965406) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8764 Product name: Recombinant human PSMB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC017198 Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 10 Calculated Molecular Weight: 273 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC017198 Gene Symbol: PSMB10 Gene ID (NCBI): 5699 RRID: AB_2171872 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40306 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.