Proteintech, 15999-1-AP, ATP5F1 Polyclonal antibody

Size: 20ul / 150ul The ATP5F1 (15999-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5F1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 15999-1-AP targets ATP5F1 in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, HeLa cells, mouse skeletal muscle tissue, mouse liver tissue Positive IHC detected in: human liver tissue, human brain tissue, human heart tissue, human kidney tissue, human skin tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information ATP5F1(ATP synthase subunit b) belongs to the eukaryotic ATPase B chain family. The ATP5F1 gene encodes subunit B of the mitochondrial ATP synthase Fo unit, which contains 214-amino acid with a 42-amino acid import signal(PMID:1831354). Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8571 Product name: Recombinant human ATP5F1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-256 aa of BC005366 Sequence: MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 Calculated Molecular Weight: 256 aa, 29 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC005366 Gene Symbol: ATP5F1 Gene ID (NCBI): 515 RRID: AB_2258817 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P24539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.