Iright
BRAND / VENDOR: Proteintech

Proteintech, 16012-1-AP, ARL1 Polyclonal antibody

CATALOG NUMBER: 16012-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARL1 (16012-1-AP) by Proteintech is a Polyclonal antibody targeting ARL1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16012-1-AP targets ARL1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, K-562 cells, HeLa cells, mouse liver tissue, HepG2 cells, Neuro-2a cells, C6 cells Positive IP detected in: Neuro-2a cells Positive IHC detected in: human stomach cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8770 Product name: Recombinant human ARL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC007000 Sequence: MGGFFSSIFSSLFGTREMRILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEAMEWLVETLKSRQ Predict reactive species Full Name: ADP-ribosylation factor-like 1 Calculated Molecular Weight: 181 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC007000 Gene Symbol: ARL1 Gene ID (NCBI): 400 RRID: AB_2243131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40616 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924