Proteintech, 16016-1-AP, TXNDC4 Polyclonal antibody

Size: 20ul / 150ul The TXNDC4 (16016-1-AP) by Proteintech is a Polyclonal antibody targeting TXNDC4 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 16016-1-AP targets TXNDC4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, MCF-7 cells, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: human breast cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information TXNDC4 is also named as KIAA0573, ERP44, PDIA10, ERp44 and belongs to the thioredoxin family (TRX). It may be involved in electron transport, protein folding, response to unfolded protein, glycoprotein metabolism, secretory pathway. It may have a role in the control of oxidative protein folding in the endoplasmic reticulum. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8818 Product name: Recombinant human ERP44 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 57-406 aa of BC005374 Sequence: WCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL Predict reactive species Full Name: endoplasmic reticulum protein 44 Calculated Molecular Weight: 406 aa, 47 kDa Observed Molecular Weight: 44-47 kDa GenBank Accession Number: BC005374 Gene Symbol: ERP44 Gene ID (NCBI): 23071 RRID: AB_1640025 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BS26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.