Proteintech, 16022-1-AP, GALM Polyclonal antibody

Size: 20ul / 150ul The GALM (16022-1-AP) by Proteintech is a Polyclonal antibody targeting GALM in WB, IHC, ELISA applications with reactivity to human, mouse samples 16022-1-AP targets GALM in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human heart tissue, human brain tissue, human spleen tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information GALM, also named as Aldose 1-epimerase, belongs to the aldose epimerase family. GALM is a mutarotase that catalyzes the interconversion of beta-D-galactose and alpha-D-galactose during galactose metabolism. GALM is involved in the maintenance of the equilibrium between the beta- and alpha- anomers of galactose, therefore ensuring a sufficient supply of the alpha-anomer for GALK1. Galm is also active on D-glucose, but its preference for galactose is higher than that of glucose. The calculated molecular weight of GALM is 38 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8842 Product name: Recombinant human GALM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-342 aa of BC019263 Sequence: MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA Predict reactive species Full Name: galactose mutarotase (aldose 1-epimerase) Calculated Molecular Weight: 342 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC019263 Gene Symbol: GALM Gene ID (NCBI): 130589 RRID: AB_2108708 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96C23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.