Proteintech, 16052-1-AP, MYLPF Polyclonal antibody

Size: 20ul / 150ul The MYLPF (16052-1-AP) by Proteintech is a Polyclonal antibody targeting MYLPF in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16052-1-AP targets MYLPF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9013 Product name: Recombinant human MYLPF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC012571 Sequence: MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE Predict reactive species Full Name: myosin light chain, phosphorylatable, fast skeletal muscle Calculated Molecular Weight: 169 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC012571 Gene Symbol: MYLPF Gene ID (NCBI): 29895 RRID: AB_2148036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A32 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.