Proteintech, 16057-1-AP, PDCL Polyclonal antibody

Size: 20ul / 150ul The PDCL (16057-1-AP) by Proteintech is a Polyclonal antibody targeting PDCL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16057-1-AP targets PDCL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, NCI-H1299 cells, Jurkat cells Positive IHC detected in: human placenta tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9029 Product name: Recombinant human PDCL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC017227 Sequence: MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEID Predict reactive species Full Name: phosducin-like Calculated Molecular Weight: 301 aa, 34 kDa Observed Molecular Weight: 40-42 kDa GenBank Accession Number: BC017227 Gene Symbol: PDCL Gene ID (NCBI): 5082 RRID: AB_2236943 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13371 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.