Iright
BRAND / VENDOR: Proteintech

Proteintech, 16058-1-AP, TSPAN1 Polyclonal antibody

CATALOG NUMBER: 16058-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPAN1 (16058-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16058-1-AP targets TSPAN1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, COLO 320 cells, rat colon tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TSPAN1 is a membrane protein of the tetraspanin superfamily, which is characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. Altered TSPAN1 expression has been associated with the progression of some neoplasms including hepatocellular carcinoma, colorectal, gastric, and breast cancers (PMID: 20890423; 19437569; 18822690; 20680643). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8786 Product name: Recombinant human TSPAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC013404 Sequence: MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTV Predict reactive species Full Name: tetraspanin 1 Calculated Molecular Weight: 241 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC013404 Gene Symbol: TSPAN1 Gene ID (NCBI): 10103 RRID: AB_2878210 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60635 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924