Proteintech, 16068-1-AP, GCDFP-15/PIP Polyclonal antibody

Size: 20ul / 150ul The GCDFP-15/PIP (16068-1-AP) by Proteintech is a Polyclonal antibody targeting GCDFP-15/PIP in IHC, ELISA applications with reactivity to human samples 16068-1-AP targets GCDFP-15/PIP in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissue, human skin tissue, human breast tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information GCDFP-15 (gross cystic disease fluid protein 15), also known as PIP (prolactin-induced protein) is a secretory glycoprotein expressed in benign and malignant breast tumor tissues and in some normal exocrine organs such as sweat, salivary, and lacrimal glands (PMID: 12393800). GCDFP-15 expression is increased by prolactin and androgen and inhibited by estrogen (PMID: 18854942). The expression is also regulated by interleukins. GCDFP-15 is a marker of apocrine differentiation and is frequently used for assessment of metastases or regional recurrences of breast origin. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9004 Product name: Recombinant human GCDFP-15, PIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-146 aa of BC010950 Sequence: AQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE Predict reactive species Full Name: prolactin-induced protein Calculated Molecular Weight: 146 aa, 17 kDa GenBank Accession Number: BC010950 Gene Symbol: GCDFP-15 Gene ID (NCBI): 5304 RRID: AB_2878212 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.