Proteintech, 16077-1-AP, ACSBG1 Polyclonal antibody

Size: 20ul / 150ul The ACSBG1 (16077-1-AP) by Proteintech is a Polyclonal antibody targeting ACSBG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16077-1-AP targets ACSBG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9043 Product name: Recombinant human ACSBG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 404-686 aa of BC009289 Sequence: AMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAVEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILE Predict reactive species Full Name: acyl-CoA synthetase bubblegum family member 1 Calculated Molecular Weight: 724 aa, 81 kDa Observed Molecular Weight: 81 kDa GenBank Accession Number: BC009289 Gene Symbol: ACSBG1 Gene ID (NCBI): 23205 RRID: AB_2878214 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96GR2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.