Proteintech, 16090-1-AP, GNB2 Polyclonal antibody

Size: 20ul / 150ul The GNB2 (16090-1-AP) by Proteintech is a Polyclonal antibody targeting GNB2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 16090-1-AP targets GNB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GNB2(Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2) is also named as G protein subunit beta-2, transducin beta chain 2 and belongs to the WD repeat G protein beta family. G proteins are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9125 Product name: Recombinant human GNB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC010073 Sequence: MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 2 Calculated Molecular Weight: 340 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC010073 Gene Symbol: GNB2 Gene ID (NCBI): 2783 RRID: AB_2111939 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.