Iright
BRAND / VENDOR: Proteintech

Proteintech, 16093-1-AP, POLR2D Polyclonal antibody

CATALOG NUMBER: 16093-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The POLR2D (16093-1-AP) by Proteintech is a Polyclonal antibody targeting POLR2D in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16093-1-AP targets POLR2D in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat liver tissue, rat skeletal muscle tissue, HepG2 cells, MCF-7 cells Positive IP detected in: mouse heart tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8701 Product name: Recombinant human POLR2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC017205 Sequence: MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY Predict reactive species Full Name: polymerase (RNA) II (DNA directed) polypeptide D Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 16-20 kDa GenBank Accession Number: BC017205 Gene Symbol: POLR2D Gene ID (NCBI): 5433 RRID: AB_2284144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15514 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924