Iright
BRAND / VENDOR: Proteintech

Proteintech, 16098-1-AP, NUDT8 Polyclonal antibody

CATALOG NUMBER: 16098-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUDT8 (16098-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16098-1-AP targets NUDT8 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human colon cancer tissue, human heart tissue, human kidney tissue, human skin tissue, mouse heart tissue, human liver tissue, human spleen tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NUDT8 belongs to the Nudix hydrolase family, which is involved in intracellular metabolic processes, especially related to the decomposition and degradation of nucleotides. NUDT8 is a novel CoA diphosphohydrolase that localizes to the mitochondria and is broadly expressed in mitochondria-rich organs such as the heart, kidneys, liver, and brown adipose tissue(PMID: 31004344). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8945 Product name: Recombinant human NUDT8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC018644 Sequence: MLPDCLSAEGELRCRRLLAGATARLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDVSFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATVVPVLAGVGPLDPQSLRPNSEEVSWGI Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 8 Calculated Molecular Weight: 236 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC018644 Gene Symbol: NUDT8 Gene ID (NCBI): 254552 RRID: AB_2154132 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WV74 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924