Iright
BRAND / VENDOR: Proteintech

Proteintech, 16115-1-AP, PPP1R8 Polyclonal antibody

CATALOG NUMBER: 16115-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1R8 (16115-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16115-1-AP targets PPP1R8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, HepG2 cells Positive IHC detected in: human kidney tissue, human spleen tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PPP1R8, also named as ARD1, NIPP1, is a 351 amino acid protein, which has a basic N- and C-terminal and an acidic central domain. PPP1R8 is ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. PPP1R8 has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates and may also be involved in pre-mRNA splicing. PPP1R8 exists many isoforms and molecular weight of modified isoforms is about 18 kDa, 28 kDa and 47 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9041 Product name: Recombinant human PPP1R8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC013360 Sequence: MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI Predict reactive species Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 8 Calculated Molecular Weight: 209 aa, 23 kDa Observed Molecular Weight: 47 kDa, 28 kDa, 19 kDa GenBank Accession Number: BC013360 Gene Symbol: PPP1R8 Gene ID (NCBI): 5511 RRID: AB_2169304 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12972 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924