Proteintech, 16122-1-AP, ARHGDIB Polyclonal antibody

Size: 20ul / 150ul The ARHGDIB (16122-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGDIB in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 16122-1-AP targets ARHGDIB in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, K-562 cells, rat spleen tissue, Jurkat cells, Raji cells Positive IP detected in: Raji cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ARHGDIB, also known as RhoGDI2, is a conserved member of the RhoGDI family and plays an important role in cell migrations. It regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. It is mainly in hematopoietic, endothelial, and epithelial cells. It has been linked to tumorigenesis and metastasis. RhoGDI2 expression is downregulated in several cancer types, such as bladder, lung and lymphoma, but is upregulated in prostate and gastric cancer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9078 Product name: Recombinant human ARHGDIB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC009200 Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE Predict reactive species Full Name: Rho GDP dissociation inhibitor (GDI) beta Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC009200 Gene Symbol: ARHGDIB Gene ID (NCBI): 397 RRID: AB_2059596 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52566 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.