Iright
BRAND / VENDOR: Proteintech

Proteintech, 16125-1-AP, PHYHD1 Polyclonal antibody

CATALOG NUMBER: 16125-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHYHD1 (16125-1-AP) by Proteintech is a Polyclonal antibody targeting PHYHD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16125-1-AP targets PHYHD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, L02 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9108 Product name: Recombinant human PHYHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-297 aa of BC009373 Sequence: MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKSPLIRTPPSCTRSPWAGCWACGSQWRMPRWRTAVSGSSLAPTPVVCQGGWSGPLLAQRLVPASLGQSQPGITASLCPPQCREGPWSSSMEKWYTRASRTSLTARARPTLSTSWRPLAPPGARRTGSSQQLNCPFPNCTPKGSRRAGALAPPG Predict reactive species Full Name: phytanoyl-CoA dioxygenase domain containing 1 Calculated Molecular Weight: 297 aa, 33 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC009373 Gene Symbol: PHYHD1 Gene ID (NCBI): 254295 RRID: AB_2163752 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SRE7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924