Iright
BRAND / VENDOR: Proteintech

Proteintech, 16126-1-AP, PGAM1 Polyclonal antibody

CATALOG NUMBER: 16126-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PGAM1 (16126-1-AP) by Proteintech is a Polyclonal antibody targeting PGAM1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16126-1-AP targets PGAM1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, NIH/3T3 cells, Raji cells, HeLa cells, HEK-293T cells, Jurkat cells, CHO cells Positive IHC detected in: human normal colon, human brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PGAM1(phosphoglycerate mutase 1) is also named as PGAMA,PGAM-B and belongs to the phosphoglycerate mutase family. Phosphoglycerate mutase is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The homodimer PGAM1 is expressed mainly in liver, kidney, brain and overexpressed in a variety of human cancers, including breast carcinoma, colorectal cancer, lung cancer, prostate cancer, oral squamous cell carcinoma, esophageal squamous cell carcinomas and also associated with certain virus infection. PGAM1 could be developed as a useful diagnostic biomarker, as well as a potential therapeutic target for hepatocellular carcinoma (PMID:20403181). This antibody may also recognize PGAM2 and PGAM4 due to the high homology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9110 Product name: Recombinant human PGAM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC011678 Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK Predict reactive species Full Name: phosphoglycerate mutase 1 (brain) Calculated Molecular Weight: 254 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC011678 Gene Symbol: PGAM1 Gene ID (NCBI): 5223 RRID: AB_2160786 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18669 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924