Iright
BRAND / VENDOR: Proteintech

Proteintech, 16204-1-AP, ACSS3 Polyclonal antibody

CATALOG NUMBER: 16204-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACSS3 (16204-1-AP) by Proteintech is a Polyclonal antibody targeting ACSS3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16204-1-AP targets ACSS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ACSS3(acyl-CoA synthetase short-chain family member 3, mitochondrial) belongs to the ATP-dependent AMP-binding enzyme family. It activates acetate so that it can be used for lipid synthesis or for energy generation. The deduced 686-amino acid protein contains 4 of 5 motifs characteristic of acyl-CoA synthetases. This protein has 2 isoforms produced by alternative splicing. The full length protein has a transit peptide with 29 amino acids. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9173 Product name: Recombinant human ACSS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-686 aa of BC009317 Sequence: DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA Predict reactive species Full Name: acyl-CoA synthetase short-chain family member 3 Calculated Molecular Weight: 686 aa, 75 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC009317 Gene Symbol: ACSS3 Gene ID (NCBI): 79611 RRID: AB_2257893 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6R3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924