Proteintech, 16213-1-AP, MRPS24 Polyclonal antibody

Size: 20ul / 150ul The MRPS24 (16213-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS24 in WB, IHC, ELISA applications with reactivity to human, mouse samples 16213-1-AP targets MRPS24 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9211 Product name: Recombinant human MRPS24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC012167 Sequence: MAASVCSGLLGPRVLSWSRELPCAWRALHTSPVCAKNRAARVRVSKGDKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRKFMWGTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKYL Predict reactive species Full Name: mitochondrial ribosomal protein S24 Calculated Molecular Weight: 167 aa, 19 kDa Observed Molecular Weight: 15-19 kDa GenBank Accession Number: BC012167 Gene Symbol: MRPS24 Gene ID (NCBI): 64951 RRID: AB_2180356 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EL2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.