Proteintech, 16224-1-AP, MRPL24 Polyclonal antibody

Size: 20ul / 150ul The MRPL24 (16224-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL24 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 16224-1-AP targets MRPL24 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, HEK-293 cells Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9277 Product name: Recombinant human MRPL24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC016700 Sequence: MRLSALLALASKVTLPPHYRYGMSPPGSVADKRKNPPWIRRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVGGLNTHYRYIGKTMDYRGTMIPSEAPLLHRQVKLVDPMDRKPTEIEWRFTEAGERVRVSTRSGRIIPKPEFPRADGIVPETWIDGPKDTSVEDALERTYVPCLKTLQEEVMEAMGIKETRKYKKVYWY Predict reactive species Full Name: mitochondrial ribosomal protein L24 Calculated Molecular Weight: 216 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC016700 Gene Symbol: MRPL24 Gene ID (NCBI): 79590 RRID: AB_2297885 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96A35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.