Iright
BRAND / VENDOR: Proteintech

Proteintech, 16256-1-AP, CHMP4C Polyclonal antibody

CATALOG NUMBER: 16256-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHMP4C (16256-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP4C in WB, ELISA applications with reactivity to human samples 16256-1-AP targets CHMP4C in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: TT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CHMP4C (Charged multivesicular body protein 4c), also known as SHAX3. It is expected to be located in the cytoplasm and membrane, which is expressed in heart, spleen and kidney. CHMP4C is one of the charged multivesicular protein (CHMP), and is involved in the composition of the endosomal sorting complex required for transport III (ESCRT-III), facilitating the necessary separation of daughter cells. CHMP4C has been proposed to be involved in the progression of different carcinomas. The molecular weight of CHMP4C is 26 kDa. Phosphorylated at Ser-210 by AURKB during cytokinesis: together with ZFYVE19/ANCHR, phosphorylated CHMP4C retains abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis. Phosphorylation and ubiquitination modification may lead to molecular weight of 35-42kd. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9279 Product name: Recombinant human CHMP4C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC014321 Sequence: MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT Predict reactive species Full Name: chromatin modifying protein 4C Calculated Molecular Weight: 233 aa, 26 kDa Observed Molecular Weight: 35 -42 kDa GenBank Accession Number: BC014321 Gene Symbol: CHMP4C Gene ID (NCBI): 92421 RRID: AB_3669233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CF2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924