Iright
BRAND / VENDOR: Proteintech

Proteintech, 16266-1-AP, RAP2B Polyclonal antibody

CATALOG NUMBER: 16266-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAP2B (16266-1-AP) by Proteintech is a Polyclonal antibody targeting RAP2B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16266-1-AP targets RAP2B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, MCF-7 cells, rat brain tissue, HEK-293 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RAP2B belongs to a family of RAS-related genes. It share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. Rap2B is a platelet protein that is activated by thrombin and involved in platelet activation. RAP2B may be a novel candidate oncogene that plays important roles in carcinogenesis through activation of NF-kappaB pathway. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9331 Product name: Recombinant human RAP2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC012362 Sequence: MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEGCCSACVIL Predict reactive species Full Name: RAP2B, member of RAS oncogene family Calculated Molecular Weight: 183 aa, 21 kDa Observed Molecular Weight: 19-22 kDa GenBank Accession Number: BC012362 Gene Symbol: RAP2B Gene ID (NCBI): 5912 RRID: AB_2177311 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61225 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924