Iright
BRAND / VENDOR: Proteintech

Proteintech, 16275-1-AP, DHRS1 Polyclonal antibody

CATALOG NUMBER: 16275-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DHRS1 (16275-1-AP) by Proteintech is a Polyclonal antibody targeting DHRS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16275-1-AP targets DHRS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, human liver tissue, mouse colon tissue, mouse testis tissue Positive IHC detected in: human kidney tissue, human skin tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DHRS1(Dehydrogenase/reductase SDR family member 1) is also named as LJ25430, MGC20204, DKFZp586I0523, SDR19C1, FLJ14250 and belongs to the short-chain dehydrogenases/reductases (SDR) family. It is involved in the metabolism of a large variety of compounds, including steroid hormones, prostaglandins, retinoids, lipids and xenobiotics.Northern blot analysis detected DHRS1express in heart highest and in liver lowest. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9351 Product name: Recombinant human DHRS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC014057 Sequence: MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF Predict reactive species Full Name: dehydrogenase/reductase (SDR family) member 1 Calculated Molecular Weight: 313 aa, 34 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC014057 Gene Symbol: DHRS1 Gene ID (NCBI): 115817 RRID: AB_2292847 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LJ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924